SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050193 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050193
Domain Number 1 Region: 50-76
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000401
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.05
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000050193
Domain Number - Region: 173-198
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0401
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050193   Gene: ENSCJAG00000012019   Transcript: ENSCJAT00000060879
Sequence length 200
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:38243758:38286484:1 gene:ENSCJAG00000012019 transcript:ENSCJAT00000060879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPAAGAARRPRCCTSWRTRYPSHVASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKAEAPPTERCFSLRMKSTLTSRGRTLNLKAATWKV
LHCSGHMRAYKPPAQTSPAGSPSSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLD
MKFTYCDDRIAEVAGYSPMT
Download sequence
Identical sequences F7GZ81
ENSCJAP00000050193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]