SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050381 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050381
Domain Number 1 Region: 263-527
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-86
Family Protein kinases, catalytic subunit 0.000000000267
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000050381
Domain Number - Region: 79-182
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0379
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050381   Gene: ENSCJAG00000014954   Transcript: ENSCJAT00000055804
Sequence length 557
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:61117896:61291703:1 gene:ENSCJAG00000014954 transcript:ENSCJAT00000055804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDPGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDD
DDDDDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRN
TEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAI
KQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTE
TCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQ
SKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIAT
NGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQVRRMVNSHVSFAVFSFLASIP
EDCQASLQPHSTDCCSK
Download sequence
Identical sequences F7FBJ2
ENSCJAP00000050381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]