SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000050736 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000050736
Domain Number 1 Region: 201-540
Classification Level Classification E-value
Superfamily Folate-binding domain 1.88e-85
Family Aminomethyltransferase folate-binding domain 0.0000178
Further Details:      
 
Domain Number 2 Region: 8-107
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.88e-28
Family L-aminoacid/polyamine oxidase 0.007
Further Details:      
 
Domain Number 3 Region: 542-587
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.0000000752
Family Aminomethyltransferase beta-barrel domain 0.0028
Further Details:      
 
Domain Number 4 Region: 108-193
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000106
Family FAD-linked reductases, N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000050736   Gene: ENSCJAG00000009864   Transcript: ENSCJAT00000061872
Sequence length 602
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:1:177781127:177850111:-1 gene:ENSCJAG00000009864 transcript:ENSCJAT00000061872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVKVPLVAIHHAYVVTERIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEE
VSDKFVFGLFDLDWEVFTQHIEGAINRVPVLEQTGIKSTVCGPESFTPDHKPLMGEAPEL
RGFFLGCGFNSAGMMLGGGCGQELAHWIIHGRPEKDMHGYDIRRFHHSLTNHPRWIRERS
HESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQERHGWERPGWFHPGGPAPVL
EYDYYGAYGSRTHKDYAYRQLLGAEHTFNFPPHQNSIKKECLACRGAAAVFDMSYFGKFY
LVGLDAREAADWLFTADVRRPPGSTVYTCMLNQRGGTESDLTVSRLAPGPQASLLAPAFE
GDGYYLAVGGAVAQHNWSHITTVLQDQKFRCQLIDSSEDLGMISIQGPASRAILQEVLDA
DLSDEAFPFSTHKVVTAAGHLVRAMRLTFVGELGWELHVPKVSCVPVYRAVMAAGAKHGL
INAGYRAIDSLSIEKGYRHWHSDLRPDDSPLEAGLAFTCRLKSPVPFLGREALEQQRAAG
LRRRLVCFTVEDKVPMFGLEAIWRNGQVVGHVRRADFGFTIDKTIATVTSATPVAGRSHW
TL
Download sequence
Identical sequences F7DPN4
ENSCJAP00000050736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]