SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051008 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051008
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 7.85e-34
Family Frizzled cysteine-rich domain 0.0001
Further Details:      
 
Domain Number 2 Region: 115-226
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000148
Family Tissue inhibitor of metalloproteinases, TIMP 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051008   Gene: ENSCJAG00000001920   Transcript: ENSCJAT00000054104
Sequence length 239
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:38714723:38723437:1 gene:ENSCJAG00000001920 transcript:ENSCJAT00000054104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSL
CVQVKDRCAPVMSAFGFPWPDMLDCDRFPQDNDLCIPLASSDHVLPTTTEEAPKVCEACK
TKNDDDNDIMETLCKNDFALKIKVKEITYINGDTKIILETKSKTIYKLNGVSEKDLKKSV
LWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences F7CJ24
ENSCJAP00000051008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]