SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051114 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051114
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily TIMP-like 1.1e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051114   Gene: ENSCJAG00000016808   Transcript: ENSCJAT00000054445
Sequence length 315
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:84843422:84848702:-1 gene:ENSCJAG00000016808 transcript:ENSCJAT00000054445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAAAGGARTAALALLLGALRWAPARGEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPL
CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIY
PCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICA
QCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKR
LVLHMKNGAGCPCPQLDGLSGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP
CSLYYPFFYGAAEPH
Download sequence
Identical sequences A0A2K5RUS5 F6ZL04
XP_002756546.1.60252 XP_017358243.1.71028 ENSCJAP00000051114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]