SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051332 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051332
Domain Number 1 Region: 75-150
Classification Level Classification E-value
Superfamily L28p-like 0.000000129
Family Ribosomal protein L28 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051332   Gene: ENSCJAG00000011847   Transcript: ENSCJAT00000053384
Sequence length 256
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:294003:378417:-1 gene:ENSCJAG00000011847 transcript:ENSCJAT00000053384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLHKYPVGLWKRLQLRQGICARLPKHFLRSLEEERTPTPVHYRPHGAKFKINPKNGQWE
RVEDVPIPIYFPRESQRGLWGGEGWIQGQRYANNDKLSKRLKKVWKPQLFDRELYSEILD
KKFTVTVTMRTLDLIDEAYGFDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPED
PERRAAIYDKYKEFVIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYAEELLQRLQR
QALSEPMLVQKRASGQ
Download sequence
Identical sequences F6TE31
ENSCJAP00000021760 ENSCJAP00000021760 ENSCJAP00000051332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]