SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051631 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051631
Domain Number 1 Region: 23-122
Classification Level Classification E-value
Superfamily Lysozyme-like 1.81e-35
Family C-type lysozyme 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051631   Gene: ENSCJAG00000014561   Transcript: ENSCJAT00000059605
Sequence length 123
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:91503265:91508583:-1 gene:ENSCJAG00000014561 transcript:ENSCJAT00000059605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTSGWTDTGDTAWLTACALPYAGVCLAYFASGFNTAAVDHEADGSTNNGIFQISSRRWCR
NLTPHVPNMCQMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTDWVDG
CDF
Download sequence
Identical sequences F6ZZA1
ENSCJAP00000051631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]