SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051701 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051701
Domain Number 1 Region: 42-81
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000491
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 2 Region: 100-128
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000536
Family CCCH zinc finger 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051701   Gene: ENSCJAG00000008403   Transcript: ENSCJAT00000063124
Sequence length 167
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:12:15405902:15415303:1 gene:ENSCJAG00000008403 transcript:ENSCJAT00000063124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKENGIQDMEQFYELWLKSQKNEKSEDVASQSNKENGKQIHMPTDYAEVTVDFHCWMCGK
NCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFSICDRYMNGTCPEGSSCKFA
HGNAELHEWEERRDALKMKLNKARKDHLIAPNDNDFGKYSFLFKDLN
Download sequence
Identical sequences A0A2K5R8V3 F6W0D6
ENSCJAP00000051701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]