SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051910 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051910
Domain Number 1 Region: 136-391
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-42
Family YWTD domain 0.0000216
Further Details:      
 
Domain Number 2 Region: 1016-1294
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-31
Family YWTD domain 0.0000505
Further Details:      
 
Domain Number 3 Region: 12-128,380-446
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.1e-22
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 924-1040,1286-1333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000471
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 5 Region: 881-921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000432
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 753-789
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000903
Family LDL receptor-like module 0.00097
Further Details:      
 
Domain Number 7 Region: 673-709
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 8 Region: 596-632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 9 Region: 474-518
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 797-841
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 11 Region: 714-751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000825
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 12 Region: 436-471
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 13 Region: 631-671
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000249
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 14 Region: 557-593
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 516-553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 1415-1450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family EGF-type module 0.022
Further Details:      
 
Domain Number 17 Region: 843-875
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 18 Region: 1517-1555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family EGF-type module 0.04
Further Details:      
 
Domain Number 19 Region: 1339-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000585
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051910
Domain Number - Region: 1378-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000101
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1452-1484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00796
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051910   Gene: ENSCJAG00000012158   Transcript: ENSCJAT00000063472
Sequence length 1728
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:79139745:79405708:1 gene:ENSCJAG00000012158 transcript:ENSCJAT00000063472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNPKCKSAEQSCNSSFFMCKNGRCIPSGGLCNNEDDCGDGSDERNCHINECLSKKVSGCS
QDCQDLPISYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCLCTDGYEI
QPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYW
IDSSRPNGSRINRMCLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGL
YPTILVSKRLKFPRDLSLDPQAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMAL
TIDYVNHRLYWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSR
AHKTSGANRFSLINSWHAITDIQVYHSYRQPDVVFKHLCMINNGGCSHLCLLAPGKTHTC
ACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQ
PGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNG
QDDCGDEEDEKDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGP
HEFQCKNNNCIPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDF
DCADGSDERNCEMSCSKDQFQCSNGQCIPAKWKCDGHEDCKYGEDEKSCEPASPTCSSSE
YICASGGCMSASLKCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDGIHDC
VDGSDEENCDRDKGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFLCP
PTRPHRCRNNRICLQSEQMCNGIDDCGDNSDEDHCSGKLTYKARPCKKDEFACSNKKCIP
MNLQCDRLDDCGDGSDEQGCRIAPTDYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRN
MKNRKCEDLNECLVFGTCSHQCINVEGSYKCECDQNFQERNNTCIAKAGSEDQVLYIAND
TDILGFIYPFNYSGDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGRE
KRQANSGLICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNG
PNCTRLLTNMAGEPYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNIQRPTG
LAVDYFSERIYWADFELSIIGSVLYDGSNSVVSVSSKQGLLHPHRIDIFEDYIYGAGPKN
GVFRVQKFGHGSVEYLALNIDKTKGVLISHRYKQLNLPNPCLDLACEFLCLLNPSGATCV
CPEGKYLINGTCNDDSLLETDDSCKLTCENGGRCIFNEKGDLRCHCWPSYSGERCEVNHC
TNYCQNGGTCIPSVLGRPTCSCALGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPYCHCQP
EYTGDRCQHYVCHHYCVNSESCTIGDDGSVECVCPTRYEGPKCEIDKCVRCHGGHCIINE
DSEDIFCNCTNGKIASSCQLCDGYCYNGGTCQLDPETNVPMCLCSANWSGTQCERPAPKS
SKSDHISTRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNP
SYNMYEVDHDHNDGGLLDPGFMIDPTKVICLKIMGINPLTFKIETYTSIFISSDKTNPIL
FQPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences F7BG31
ENSCJAP00000051910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]