SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000051996 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000051996
Domain Number 1 Region: 335-433
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.61e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000051996
Domain Number - Region: 185-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0151
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000051996   Gene: ENSCJAG00000000428   Transcript: ENSCJAT00000063208
Sequence length 483
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:154800937:154832899:-1 gene:ENSCJAG00000000428 transcript:ENSCJAT00000063208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYAEFPSSPSNPTKEPMEPQPSQVPLPEDMDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDTHQSPDAFSLMMAKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKASEEYYQLLMSSEGHPCGADVPSYTVEEIES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHCKRDAFSDAKFVEFLAPHDVGVFH
SFTSPYKLPSWSVCSGADSFTQECCMEEKSFFCRVSVGKSHENEIRYHPFRMTPYLVKVR
GRQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQ
DLTETSVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRARNGEYITLDTSWSSFIN
PWSRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKPLHPSMQELTEQIHRLLLQVGAVPAC
PPR
Download sequence
Identical sequences F6YVR7
ENSCJAP00000051996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]