SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052076 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052076
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000077
Family Extracellular domain of cell surface receptors 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052076   Gene: ENSCJAG00000035967   Transcript: ENSCJAT00000064075
Sequence length 126
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:40541793:40542173:1 gene:ENSCJAG00000035967 transcript:ENSCJAT00000064075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLGWLLLLVMALTPGTTSVKDCIFCELTDSTQCPGTPMRCGDDEDCFTGLGVAPGTSPV
INKGCMQATRCGREEPVSYKGVTYSLTTTCCDGHLCNRAPGPASSQMSGATTSLALGLGM
LLPRLL
Download sequence
Identical sequences F7IGW5
XP_008986582.1.60252 ENSCJAP00000052076 ENSCJAP00000052076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]