SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052097 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052097
Domain Number 1 Region: 1-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.94e-29
Family G proteins 0.00000105
Further Details:      
 
Domain Number 2 Region: 238-323
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000000000173
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000513
Further Details:      
 
Domain Number 3 Region: 148-219
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000628
Family Elongation factors 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052097   Gene: ENSCJAG00000009636   Transcript: ENSCJAT00000018668
Sequence length 333
Comment pep:novel chromosome:C_jacchus3.2.1:10:119465513:119466875:-1 gene:ENSCJAG00000009636 transcript:ENSCJAT00000018668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GITINAAHVEYSTAARRSAHTDCQGHTDYVRNMLQGTTPLDSCILAVAANDSRMPQTREH
FLLARQIGVEHVVVCVNKADAVQDSMVEPVELLEIRELLPKFGYKGEETPLIVGSALCAL
EDWDPDLGLKSVQKLLDAVDTYIPVPTRDPEKPFLLPMESGYSIPGHGSAATGMLERGIL
KKGDDCELLGHSKSICTVVTSTEMVLKSLERAEAGDNLRGLTYGPPGRGQAGSLQLFPKV
EAQVYILSKEKGGHHSPLCPSTSYHDMACRVILPPERSLLCPGDLKLNLIFQQPMILEKG
QHVTLRDGNGTISTSLVTDTPAMTEEEKNIKWA
Download sequence
Identical sequences F7IEL8
ENSCJAP00000052097 ENSCJAP00000052097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]