SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052118 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052118
Domain Number 1 Region: 124-357
Classification Level Classification E-value
Superfamily RNI-like 1.06e-26
Family Cyclin A/CDK2-associated p19, Skp2 0.0000000162
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000052118
Domain Number - Region: 80-112
Classification Level Classification E-value
Superfamily F-box domain 0.000392
Family F-box domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052118   Gene: ENSCJAG00000032364   Transcript: ENSCJAT00000035831
Sequence length 358
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:2389524:2391285:1 gene:ENSCJAG00000032364 transcript:ENSCJAT00000035831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKHLQEIPDLSSNIAASFSELLSGLGVSALEKEEPEGQNIPQELLSNLGLPHSPPRKR
LKSKGSDKDFVIVLRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPEVLKVSGLRWQTLD
LTGQNLHPDVTGRLLSQRAIAFRCPGSFMDQPLAEHFSPFHVQHVDLLISVIEVSTLQGI
LPQCSKLQNLSLEGLRLLDPVVNNLAQNSNLVRLNLCGRSGFSEFALQTLLSGSSIRDEL
NLSWCFDFTGKHVQVAAAHVSDTIAQLNLSGYRKNLQKSDLSTLVKRCPSLAHLDVNNCF
PEIFQLNYLQHLSLSRCYDPETLLELGEIPTLKTLQVFGIAPDGTLQLLKEALPQLQM
Download sequence
Identical sequences F7I2R1
ENSCJAP00000052118 ENSCJAP00000052118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]