SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000052171 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000052171
Domain Number 1 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.81e-26
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000052171   Gene: ENSCJAG00000032315   Transcript: ENSCJAT00000065286
Sequence length 79
Comment pep:novel chromosome:C_jacchus3.2.1:22:19598934:19603695:1 gene:ENSCJAG00000032315 transcript:ENSCJAT00000065286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLEFRDVAVEFSLEEWHCLDAAQRNLYRDVMLENYGNLVFLGIVVSKPDLITCLQQGKK
PLTVKRHEMIATPPGMCHH
Download sequence
Identical sequences F7HY05
ENSCJAP00000052171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]