SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000000654 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000000654
Domain Number 1 Region: 410-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 2 Region: 270-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.76e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 325-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.98e-24
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 199-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-19
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 8 Region: 456-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000105
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 372-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000675
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 83-128
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000359
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000000654   Gene: ENSCJAG00000000381   Transcript: ENSCJAT00000000701
Sequence length 591
Comment pep:novel chromosome:C_jacchus3.2.1:22:48276481:48474202:-1 gene:ENSCJAG00000000381 transcript:ENSCJAT00000000701 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSQQGTVTFEDVAVNFSREEWSLLSEVQRCLYHDVMLENWVLTSSLGCWCESEYEEAPS
KQNISIQRVSPVSSPRAGVSLKKAHPCEMCGAVLGDISHLADHQGTHHKQKLHRCEAWGN
QFYDSSNHQHQNQYLGEKPYRSSVEEALFVRRCKFHVSEESSVFSQSGKDFLPSSGLLQQ
EATHTGEKSDSKTEHHRVHTRERPYECGECGKSFSRKGHLRNHQRGHTGERPYECGECGK
SFSRKGNLIQHQRSHSGERPYECRECRKLFRGKSHLTEHQRVHTGERPYECNECGKSFQD
SSGFRIHQRVHTGEKPFECSECGKSFPQSCSLLRHRRVHTGERPYECGECGKSFHQSSSL
LRHWRVHTGEKPYECQECGKCFRQSSSLIQHRRVHTAVRPHECGECGKLFSNKSNLIKHR
RVHTGERPYECSECGKSFSQRSALLQHRGVHTGERPYECSECGKFFTYHSSLIKHQKVHS
GSRPYECSKCGKSFSQNSSLIEHHRVHTGERPYKCSECGKSFSQRSALLQHRGVHTGERP
YECSECGKFFPYSSSLRKHQRVHTGSRPYECSECGKSFTQNSGLIKHRRVH
Download sequence
Identical sequences F6QAT6
ENSCJAP00000000654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]