SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001121 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001121
Domain Number 1 Region: 245-404
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.56e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000309
Further Details:      
 
Domain Number 2 Region: 32-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.28e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 3 Region: 145-242
Classification Level Classification E-value
Superfamily LCCL domain 4.05e-24
Family LCCL domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001121   Gene: ENSCJAG00000000646   Transcript: ENSCJAT00000001191
Sequence length 743
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:97985575:98093539:1 gene:ENSCJAG00000000646 transcript:ENSCJAT00000001191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFLLLLLVLLLLLEDAGAQQGDGCGHTVLGPESGTLTSINYPQTYPNSTVCEWEIRVK
MGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKSNEIT
LLFMSGIHVSGRGFLASYSVIDKQDLITCLDTASNFLEPEFSKYCPAGCLLPFAEISGTI
PHGYRDSSPLCMAGVHAGVVSNTLGGQISVVISKGIPYYESSLANNVTSVVGHLSASLFT
FKTSGCYGTLGMESGVIADPQITASSVLEWTDHTGQENSWKPEKARLKKPGPPWAAFVTD
EYQWLQIDLNKEKKITGIITTGSTMVEHNYYVSAYRVLYSDDGQKWTVYREPGVEQDKIF
QGNKDYHQDVRNNFLPPIIARFIRVNPTQWQQKIAMKMELLGCQFIPKGRPPKLTQPPPP
WNNNDLKNTTTSPKIAKGRAPKFTQPLQPRSSNEFPAQTEQTTATPDIRNTTVTPNVTKD
VALAAVLVPVLVMVLTTLILVLVCAWHWRNRKKKTEGTYDLPYWERAGFYLTVSLAYCHN
EGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGT
LHQRSTFKPEEGKEAGYADLDPYNSPVQEVYHAYAEPLPVTGPEYATPIIMDMCGHPTAS
AGLPSTSTFKATGNQPPPLVGTYNTPLSRTDSCSSAQAQYDTPKGGKPGPAAPDELVYQV
PQSVQEVSGAGRNGECNVSKEIL
Download sequence
Identical sequences F6W3P1
ENSCJAP00000001113 ENSCJAP00000001121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]