SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001346 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001346
Domain Number 1 Region: 154-381,425-474
Classification Level Classification E-value
Superfamily MFS general substrate transporter 4.05e-46
Family LacY-like proton/sugar symporter 0.068
Further Details:      
 
Domain Number 2 Region: 590-731
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.93e-19
Family Glycerol-3-phosphate transporter 0.07
Further Details:      
 
Domain Number 3 Region: 498-578
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000011
Family Pentapeptide repeats 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001346   Gene: ENSCJAG00000000779   Transcript: ENSCJAT00000001429
Sequence length 742
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:3870030:3880431:-1 gene:ENSCJAG00000000779 transcript:ENSCJAT00000001429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGFRDRAAFIRGAKDIAKEVKKHAAKKVVKGLDRVQDEYSRRSYSRFEEEEDDDDFPA
PTDGYYRGEGTQDEEEGGASSDATEGHDEDDEIYEGEYQGIPRAESGGKGERMADGAPLA
GVRGGLSDGEGPPGGRGEAQRRKEREELAQQYEAILRECGHGRFQWTLYFVLGLALMADG
VEVFVVGFVLPSAEKDMCLSDSNKGMLGLIVYLGMMVGAFLWGGLADRLGRRQCLLISLS
VNSVFAFFSSFVQGYGTFLFCRLLSGVGIGGSIPIVFSYFSEFLAQEKRGEHLSWLCMFW
MIGGVYAAAMAWAIIPHYGWSFQMGSAYQFHSWRVFVLVCAFPSVFAIGALTTQPESPRF
FLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRW
GVRALSLGGQVWGNFLSCFGPEYRRITLMMMGVWFTMSFSYYGLTIWFPDMIRHLQAVDY
ASRTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVT
SSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVYFV
SFLGTLAVLPGNIVSALLMDKIGRLRMLAGSSVMSCVSCFFLSFGNSESAMIALLCLFGG
VSIASWNALDVLTVELYPSDKRTTAFGFLNALCKLAAVLGISIFTSFVGITKAAPILFAS
AALALGSSLALKLPETRGQVLQ
Download sequence
Identical sequences F7C0F3
XP_002759902.1.60252 ENSCJAP00000001346 ENSCJAP00000001346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]