SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000001355 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000001355
Domain Number 1 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 3-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-25
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 4 Region: 513-565
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-21
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 335-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000448
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 6 Region: 434-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000732
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 7 Region: 223-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000285
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000001355
Domain Number - Region: 269-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00447
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000001355   Gene: ENSCJAG00000000788   Transcript: ENSCJAT00000001438
Sequence length 578
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:18728395:18776739:-1 gene:ENSCJAG00000000788 transcript:ENSCJAT00000001438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFQEQVSFKDVCVDFTEEEWYLLDPAQKMLYRDVILENYSNLVSVGYCITKPEVIFKI
EQGEEPWILEKGFPSQCHPERKWKADDVLESSQDHEDDHFWELLFHNNKRVSAESGDKER
KTFNLGTDPVSLRNYPYKICDSCEMSLKNISGLIINKKNCSRKKPDEFNVCEKLLLDIRH
EKIPFGEKSYKYDQKRNAINYHQDLSQPIFDQTFEYNKNGQGFHDEAAFLTNKRSQIGET
VCKYNECGRTFIESLKLNVSQRTHLEMEPYGCSICGKSFCVDLRFGHQRALPKDNPYEYN
EYGEICDNSAFLIHQGAYPRKILREYKVSDKTWEKSTLLKHQIIHVGGKSYNYNENGSNF
SKKSHLTQLRRAHAGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQKP
HLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPYECNACGKSFCHRSALTV
HQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNECGKTFCEKSALTKHQRT
HTGEKPYECNACGKTFSQRSVLTKHQRIHMRVKALSTS
Download sequence
Identical sequences F7BZY5
ENSCJAP00000001355 XP_008985836.1.60252 XP_008985838.1.60252 XP_017823450.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]