SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002017 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002017
Domain Number 1 Region: 61-161
Classification Level Classification E-value
Superfamily PH domain-like 0.00000004
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002017   Gene: ENSCJAG00000001172   Transcript: ENSCJAT00000002135
Sequence length 207
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:65703435:65704419:-1 gene:ENSCJAG00000001172 transcript:ENSCJAT00000002135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCLLRVSFLCALRAGGRGSRWGEDGARLLLLPPARAAGSGEAEPNGGPAYAGRMLESSGC
KALKEGVLEKRSDGLLQLWKKKCCILTEEGLLLIPPSGQGPAEPSQPSGPAVTALEPPVK
LKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMVQYKNRQA
ILAVKSTRQKQQHLVQQQPPLEPPPTP
Download sequence
Identical sequences F7I510
ENSCJAP00000002017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]