SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000002547 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000002547
Domain Number 1 Region: 546-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000374
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 583-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000162
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.00000536
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000791
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000002547   Gene: ENSCJAG00000001421   Transcript: ENSCJAT00000002689
Sequence length 680
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:98792134:98800287:1 gene:ENSCJAG00000001421 transcript:ENSCJAT00000002689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHATARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLAIQTSALRVR
MVRGELVDESGGSPLEWIGLIRAARNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVFSSGGGGAF
LHHEQAARQGAVPAADGLRLSPKPSAPDFPAPSQAGTLRSHPQGPPPAQACGAREVITRE
ASSVPSDTSSTPCKVGPAPRKARSQLDRALEHERGRPRTRPTSSSIVGGSSAGVGSLAFY
PGRSAFKPRGAKRGASAAHSTPYREESGSKPGTGLALGRLLGEGRAGGRLGNGENSAGGG
AAKCLLAGAGLPCSGTLRGFPLLSLHPEEASAFKHVERAPPAASALPGARYQQLPPAPGL
PFERCALPPLDTGGLKAYPSGECSHLPAVMPAFTVYNGELLYGSPATTAYYPLKLHFGGL
LKYPESISYFSGPTAAALSPAELGSLASIDREIAMHNQQLSEMAAGKGRGRLDSGTLPAG
KPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGN
TPYRCEFCGKVLVRRRDLERHVKSRHPGQSLLAKAGDGPGPEPGYPPEPGDPKSDDSDVD
VCYTDDQSDPEAGGGGERDL
Download sequence
Identical sequences F7IL34
ENSCJAP00000002547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]