SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003196 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003196
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.61e-35
Family SCAN domain 0.00012
Further Details:      
 
Domain Number 2 Region: 228-289
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 761-812
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-20
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 5 Region: 678-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 862-914
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 976-1028
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-16
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 8 Region: 605-660
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000178
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 9 Region: 832-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000455
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 535-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000496
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number 11 Region: 444-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000529
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000003196
Domain Number - Region: 953-987
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0399
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003196   Gene: ENSCJAG00000001780   Transcript: ENSCJAT00000003372
Sequence length 1031
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:20159487:20168729:-1 gene:ENSCJAG00000001780 transcript:ENSCJAT00000003372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPGRWHAVYPAQAQSSRERGRLQTVKKEEEDESYTPVQAARPQTLNRPGQELFRQLFRQ
LRYHESSGPLETLSRLRELCRWWLRPDVLSKAQILELLVLEQFLSILPGELRVWVQLHNP
ESGDEAVALLEELQRDLDGTSHRDPGPVQSPDVHWMGTGALRSAQIWSLASPLRSGSALG
DHLESPYEIEARDFLAGQSDPPAAQMPALFQREGCPGDQVTATRSLTAQLQETMTFKDVE
VTFSQDEWGLLDSAQRNLYRDVMLENYRNMAFLVGPFTKPALISWLEAREPWGLNVQVAQ
PKRNPGAAPTGGDLQIKTKKFILNQEPLEGAETLAVPSECPAASVSEGIGLRESFQQKNR
LKDQCENPIQVRVKKEETDFSHRTGKDSEVSGGNSLDLKHVTYLRVSGRKQSLKHGCGKH
FRMSSHHYDYKKYGKGLRHMIGGFSIHQRIHTGLKGSKKDLCGKDFSLSSHHQHGQSLHT
VGVSFKCSDCGRTFSHSSHLAYHQRLHSQEKAFKCRVCGKAFRWSSNCARHEKIHTGVKP
YKCDLCEKAFRRLSAYRLHQETHAKKKFLELNQYRAALTYSSGFDHHLGDQSGEKLFDCS
QCRKSFHCKSYVLEHQRIHTQEKPYKCNKCRKTFRWRSNFTRHMRLHEEEKFYKQDECCE
DFRQAPDHSQPQGAPPVEKTFLCQQCGKSFTRKKTLIDHQRIHTGEKPYQCGECGKDFAY
RSAFIVHKKKHAMKGKPEGGPSFSQDRVFQVPQSSHTREEPYQCSQCGKAFRNHSFLLIH
QRVHTGEKPYKCRECGKAFRWSSNLYRHQRIHSLQKQYDCHESEKTPDMEPKILTGEKRF
WCQECGKTFTRKRTLLDHKGIHSGEKRYKCNLCGKSYDRNYRLVNHQRIHTKERPFKCQW
CGKEFIGRQTLSSHQSKHTRAAQAEHSPPGLSSSQDTKLRLQKLKPSEEMPLEDCEEACD
QSSRLDELQDITTGKKCHKCSICGKTFSKSSQLISHKRFHTRERPFKCSKCGKTFRWSSN
LARHMKNHIRD
Download sequence
Identical sequences F7HFN5
XP_017820323.1.60252 ENSCJAP00000003196 ENSCJAP00000003196

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]