SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003266 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003266
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.34e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 740-797
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.84e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 797-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.8e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 909-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 853-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 461-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 10 Region: 209-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 685-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-19
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 12 Region: 572-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 364-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 950-1002
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000474
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003266   Gene: ENSCJAG00000001817   Transcript: ENSCJAT00000003446
Sequence length 1027
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:20330240:20348729:1 gene:ENSCJAG00000001817 transcript:ENSCJAT00000003446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHRPGSGEEAVALVEEL
QKDLDGPTIKVPVLAQDQSPLQKAVSTPGTLPPVLPGSHIAAEICLHPTDPVAFNFQDPQ
NDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALY
WDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSQKGTSKRLQGSVPQVLHFEEECE
WQVLASQWENETEERADTMKKGSLCEREKKKRTPPEKQGRKWKEFGESLTFGSPVSESLI
GTEGKKFYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHSG
EKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERPY
KCNDCGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCDE
CGKTFAQTTYLIDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGKI
FSSKSNFIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFILK
KSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKSFM
VHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSDCGRAFSSNRNLIEHKR
IHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIHTG
EKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEKPY
KCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCND
CHKVFRQRKNLTVHQKIHTDEKPCECDASEKEFSQTSNFHLHQKIHTIEEFSWLQSTNES
KIKIQKI
Download sequence
Identical sequences F7GPK9
ENSCJAP00000003266 XP_008979744.1.60252 XP_017820331.1.60252 XP_017820332.1.60252 XP_017820333.1.60252 ENSCJAP00000003266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]