SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005381 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005381
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.56e-123
Family Transglutaminase core 0.00000000957
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily E set domains 2.69e-45
Family Transglutaminase N-terminal domain 0.00019
Further Details:      
 
Domain Number 3 Region: 610-707
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.44e-24
Family Transglutaminase, two C-terminal domains 0.00076
Further Details:      
 
Domain Number 4 Region: 487-607
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.59e-22
Family Transglutaminase, two C-terminal domains 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005381   Gene: ENSCJAG00000002937   Transcript: ENSCJAT00000005679
Sequence length 712
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:20411491:20426407:-1 gene:ENSCJAG00000002937 transcript:ENSCJAT00000005679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLVATLQLESVDLQISRNNKEHHTQEMGINRLTVRRGQPFHLRLSFSRPFQSKTNHITF
VAETGPKPSELLGTRATFFLTRVRPGNVWSASDFTTDSNSLQVSLFTPANAVIGHYTLKI
EISQGQDHSVTYLLGTFILLFNPWSAEDDVYLPSEILLQEYVMRDYGFVYKGHERFITSW
PWNYGQFEEDVIDICFEILNKSLYYLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSKGVSPLEWNGSVAILRQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYDRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRQSITSSYKYPEGSSEERAVFMKASRKMLGPQRASSPFLDLL
ESRDLRNQPVQLQLHLARMPEWGQDLQLLLRIWRVPDSTHPWGPIRLVVHFCAQALLHGG
GTQKPLWRHMVRLNLDFGKGLETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSML
VLKDVSLEPPHLSIEVSERAEVGKALRVHITLTNNLMVALSSCMMVLEGSGLVNGQIAKD
LGTLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKNIFVTAAGAP
Download sequence
Identical sequences F7ICD6
ENSCJAP00000005381 ENSCJAP00000005381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]