SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005545 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000005545
Domain Number - Region: 67-142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005545   Gene: ENSCJAG00000003060   Transcript: ENSCJAT00000005850
Sequence length 159
Comment pep:novel chromosome:C_jacchus3.2.1:3:52561771:52572647:-1 gene:ENSCJAG00000003060 transcript:ENSCJAT00000005850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRRIFSSQDWRVRGRDEAGLFFRRTFCGRSGRSCRCQLVQVSPPEVSAASFSLPAPPAE
DHSARIFYRRPKSLLPKMMNADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDA
VKEENLKLKSENQVLGQYIENLMSASSVFQTTDTKSKRK
Download sequence
Identical sequences F7IJH1
XP_002745383.1.60252 ENSCJAP00000005548 ENSCJAP00000005545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]