SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006829 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006829
Domain Number 1 Region: 15-357
Classification Level Classification E-value
Superfamily Sema domain 3.14e-86
Family Sema domain 0.0000984
Further Details:      
 
Domain Number 2 Region: 1199-1328,1524-1712
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-51
Family p120GAP domain-like 0.037
Further Details:      
 
Domain Number 3 Region: 800-889
Classification Level Classification E-value
Superfamily E set domains 2.57e-18
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 4 Region: 888-991
Classification Level Classification E-value
Superfamily E set domains 3.44e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.054
Further Details:      
 
Domain Number 5 Region: 704-801
Classification Level Classification E-value
Superfamily E set domains 0.00000000000084
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 355-401
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000562
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 988-1069
Classification Level Classification E-value
Superfamily E set domains 0.0000000714
Family E-set domains of sugar-utilizing enzymes 0.044
Further Details:      
 
Domain Number 8 Region: 656-690
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000406
Family Plexin repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006829   Gene: ENSCJAG00000003770   Transcript: ENSCJAT00000007213
Sequence length 1743
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:29987591:30185509:-1 gene:ENSCJAG00000003770 transcript:ENSCJAT00000007213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XVEPSHKTEHYLSSVKTGTMYGVRSESDDGKLFISTAVDRKQDYFPTLSSRKLPRDHESA
MLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIYGFASGSFVYFLTVQPETPEGVAINSA
GDLFYTSRIVRLCKDDPKFHSYVSLPFGCTRAGVEYRLLQAAYLAKPGDSLAQAFNISSQ
DDVLFAIFSKGQKQYHHPPDDSALCAFPIRAINLQIKERLQSCYQGEGNLELNWLLGKDV
QCTKAPVPIDDNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTK
SGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSIDQRYLYIMSERQVTRVPVESC
EQYTTCGECLSSGDPHCGWCALHNMCSRKDKCQQAWEPNRFAASISQCVSLEVHPSSISV
SEHSRLLSLVVSDAPDLSAGIACAFGNLTEVEGQVSGSQVICISPGPKDVPVIPLDQDWF
GLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPTTCSFQ
EGRINVSEDCPQLVPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVP
ALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWNGNFIIDNPQDLKVHLYKCAAQRESC
GLCLKADRKFECGWCSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPE
GGTRVTIHGVNLGLDFSEIAHHVQVAGVPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVH
LCIGECKPEFMTKSHQQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVSVYLGN
QTCEFYGRSMSEIVCVSPPSSNGLGPVPVSVSVDRARVDNSLQFEYIDDPRVQRIEPEWS
IASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPSLTTDYRPGLD
TVERPDEFGFVFNNVQSLLIYNDTKFIYYPNPTFELLSPTGVLDQKPGSPIILKGKNLCP
PASGGAKLNYTVLIGETPCAVTVSETQLLCEPPNLTGQHKVMVHVGGMVFSPGSVSVISD
SLLTLPAIVSIAAGGSLLLIIVIIVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKE
AFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIEDHPVLRELEVQGNGQQHVEKA
LKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSD
LIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKECAGEPLFMLYCAIKQQMEK
GPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEK
ILDAVYKNVPYSQRPRAVDMDLEWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSD
RSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMITPDLESGVKV
WHLVKNHDHGDQKEGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETLFSTVHRGSALPL
AIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKGSITDACL
SVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNA
YLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMS
IES
Download sequence
Identical sequences F7DGF6
ENSCJAP00000006829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]