SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007268 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007268
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.16e-59
Family Dystroglycan, domain 2 0.000000318
Further Details:      
 
Domain Number 2 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 8.47e-19
Family Dystroglycan, N-terminal domain 0.00000251
Further Details:      
 
Domain Number 3 Region: 497-597
Classification Level Classification E-value
Superfamily Cadherin-like 1.29e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007268   Gene: ENSCJAG00000003999   Transcript: ENSCJAT00000007678
Sequence length 895
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:15:25208060:25255733:1 gene:ENSCJAG00000003999 transcript:ENSCJAT00000007678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMSVGLSLLLPVWGRTFLLLLSVAMAQSHWPSEPSEAVRDWENQLEASMHSVLSELHEA
IPTVVGIPDGTAVVGRSFRVTIPTDLIASSGDIIKVSAAGKEALPSWLHWDPNSHTLEGL
PLDTDKGMHYISVSAARLGANGSHIPQTSSVFSIEVYPEDHSELQSVRTASPDPGEVVSS
ACAVDEPVTVLTVILDADLTKMTPKQRIDLLHRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVEAPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRVRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEASTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRI
RTTTGGVPRGGELNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDHEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHRRPQ
GDRAPARFKAKFVGDPAPVLNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKDQIVGLSRRIAEDDGRPRPAFSNALEPDFKATSIGVMGAGSCRHLQFIP
VAPPRRVPSEVPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLQDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences F6TRX4
XP_017820394.1.60252 ENSCJAP00000007268 ENSCJAP00000007259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]