SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008925 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008925
Domain Number 1 Region: 32-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000654
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 119-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000458
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 3 Region: 84-113
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000969
Family LDL receptor-like module 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008925   Gene: ENSCJAG00000004890   Transcript: ENSCJAT00000009430
Sequence length 162
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:89276932:89286342:-1 gene:ENSCJAG00000004890 transcript:ENSCJAT00000009430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVFPEGENGRIAAGPKALPGGEGAQACTTLTNRTGFLCRDQRSCIPASGVCDGVRTCT
HGEDEDESLCRDVPHSLPRFLVAHCGDPASWIYSDQKCDGTNNCGDCSDELSPVTVCPLC
GPGWWPCPSTVFKYCGCIPRRLCRDHVQHCSDWSDEYACPGP
Download sequence
Identical sequences F7I5Q2
ENSCJAP00000008925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]