SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009086 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009086
Domain Number 1 Region: 1188-1292,1343-1496
Classification Level Classification E-value
Superfamily Cullin homology domain 8.76e-42
Family Cullin homology domain 0.00066
Further Details:      
 
Domain Number 2 Region: 776-968
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.44e-35
Family APC10-like 0.0064
Further Details:      
 
Domain Number 3 Region: 359-433
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 7.22e-32
Family CPH domain 0.00000674
Further Details:      
 
Domain Number 4 Region: 139-200,665-779
Classification Level Classification E-value
Superfamily ARM repeat 0.000000326
Family RPA1889-like 0.068
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000009086
Domain Number - Region: 1517-1616
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00484
Family Penicillinase repressor 0.036
Further Details:      
 
Domain Number - Region: 963-1049,1095-1174
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.0296
Family Cullin repeat 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009086   Gene: ENSCJAG00000004960   Transcript: ENSCJAT00000009599
Sequence length 1668
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:44352835:44366954:-1 gene:ENSCJAG00000004960 transcript:ENSCJAT00000009599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGELRYREFRVPLGPGLHAYPDELIRQRVGHDGHPEYQIRWLILRRGDDGDGVAGQVDC
KAEHILLWMSKDEIYANCHKMLGEDGQVIRPSQSAGEVGALDKSVLEEMETDVKSLIQRA
LRQLEECVGTIPPAPLLHTVHVLSAYASIEPLTGVFKDPRVLDLLMHMLSSPDYQIRWSA
GRMIQALSSHDAGTRTQILLSLSQQEAIEKHLDFDSRCALLALFAQATLSEHPMSFEGIQ
LPQVPGRVLFSLVKRYLHVTSLLDQLNDSAVEAGTQNTSAPEELSGERGQLELEFSMAMG
TLISELVQAMRWNQASDKPRSSARFPGSIFQPQLTAVSPGLPTAQAQPSFRRSRRFRPRS
EFASGNTYALYVRDTLQPGMRVRMLDDYEEISAGDEGEFRQSNSGVPPVQVLWESTGRTY
WVHWHMLEILGFEEDIEDVVESDEYHGVVANGVLGRALPTWRWRPITELYAVPYVLPEDE
DTEEREYLTLAEWWELLFFIKKLEGPDRQEILQILQENLDGEILDDEILAELAVPIELAQ
DLLLTLPQRLNDSALRDLINCHVYKQYGPQALAGQPPYPSLLEAQQGVLLEAQAQAKDSE
DAAKVEAKEPPSQSPNTPLERLVESYGPAGKILLDLEQALSSEGTQENKVKPLLLQLQRQ
PQPFLALMRSLDTPETNRALHLTVLRILKQLVDFPEALLLPWHEAVDACMACLRSPNTDR
EVLQELIFFLHHLTSVSRDYAVVLNQLGARDAISKALEKHLGKLELAQELRDMVFKCEKH
AHLYRKLITNILGGCIQMVLGQIEDHRRTHRPINIPFFDVFLRYLCQGSSVEVKEDNCWE
KVEVSSNPHRASKLMDHNPKTYWESNGSTGSHHITLHMRQGILVRQLTLLVASEDSSYMP
ARVVVCGGDSTSSLHTELNSVNVMPSASRVILLENLTRFWPIIQIRIKRCQQGGIDTRIR
GLEILGPKPRFWPVFREQLCRHTRLFYMVRAQAWSQDLAEDRRSLLHLSSRWNAALRQEH
NFADRFFPDDESAQELGKTCWEALVNPCITITSPGNQPRPQLFFSRVRRLTHLVHVEPCE
APPPVAATPRPKGRNRSHDWSSLATRGFPSSIMRNLTRCWQAVVEKQVDNFLTSSWRDDD
FVPRYCEHFNILQNSSSELFGPRAAFLLALQNGCAGALLKLPFLKAAHVSEQFARHIDQQ
IQGSRIGGAQEMERLAQLQQCLEAVLIFSGLEIATTFEHYYQHYMADRLLGVFSSWLEGA
VLEQIGPCFPNRLPQQMLQNLSTSKELQRQFHVYQLQRLDQELLKLEDTEKKIQVDHEAS
GKEHKSEKEEGAGAAAAVDAAEEEEENEDLYYEGAMPEVSVLVLSRHCWPVASICHTLNP
RTCLPSYLSGTLNRYSNFYNKSQSHPALERGSQRRLQWTWLGWAELQFGNQTLQVSTVQM
WLLLYLNDLKSISVESLLALSGLSADTLNQAIGPLTSSRGPLDLHEQKDIPGGVLKIRDG
SKEARSRWDTVRLIPPQTYLQADDEEGRNLEKRRNLLNCLIVRILKAHGDEGLHIDQLVC
LVLEAWQKGPCPPRGLVSSLGKGSACSSTDVLSCILHLLGKGTLRRHDDRPQVLSYAVPV
TVMEPQTESLNPGSSGPNPPLTFHTLQIRSRGVPYASSTGTQSFSTFR
Download sequence
Identical sequences F7HZE1
ENSCJAP00000009086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]