SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009776 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009776
Domain Number 1 Region: 345-579
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 3-135,185-255
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.22e-28
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009776   Gene: ENSCJAG00000005329   Transcript: ENSCJAT00000010325
Sequence length 633
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:22682786:22707735:-1 gene:ENSCJAG00000005329 transcript:ENSCJAT00000010325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQ
SNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFM
VIIYAIIGLELFKGKMHKTCYFTGTDIVATVENEEPSPCARTGSGRRCTINGSECQGGWP
GPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFIL
NLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGEVMDVEDFREGKL
SLDEGGSDTESLYEIAGLNKVIQFIRHWRQWNRIFRWKCHDIVKSKVFYWLVILIVALNT
LSIASEHHNQPLWLTHLQDIANRVLLSLFTIEMLMKMYGLGLRQYFMSIFNRFDCFVVCS
GILEVLLVEVGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLL
FLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQSFSSEDWTSMMYNGIMA
YGGPAYPGVLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEERKRRKM
SKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAK
Download sequence
Identical sequences F7GWR2
ENSCJAP00000009776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]