SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009837 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009837
Domain Number 1 Region: 405-530
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.22e-27
Family DEP domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 228-339
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-23
Family PDZ domain 0.0000373
Further Details:      
 
Domain Number 3 Region: 2-78
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.61e-19
Family DIX domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009837   Gene: ENSCJAG00000005366   Transcript: ENSCJAT00000010394
Sequence length 684
Comment pep:known_by_projection scaffold:C_jacchus3.2.1:GL286591.1:22351:24451:-1 gene:ENSCJAG00000005366 transcript:ENSCJAT00000010394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAETKIIYHMDEEETPYLVKLPVAPERVKLADFKNVLRNRPKFFFKSMDQDFGVVKEEIL
DDNAKLLCFNGRVVSWLVLAEGAHSDASSQGTDSHTDLPPPLERTGGIGDSRPPSFHPNV
ASSRDGMDNETGTESMVSHPGERARRRNREEAARTNGYPRGDRRRDVGLDSASTALSSEL
ESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRMHKLRWRKQRLRQTDRASSSSSITDSTMS
LNIITVTLNMERHHFLGISIVGQSKDHGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVND
VNLENMNNEDAVRVLREIVSQTGPISLTVAKCWDPTPSSYFTVPRADPVRPIDPAAWLSH
AAALTAALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLMVSDMGAVVRVMQLPNS
GLEIRDRMCLKITIHTVIGAHVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNKIT
FSEQCFGDLCSNLTALNLNSGSSGASDWDTLALLPHPTTPWPLGQCYRYQYLGPPPCFPP
SYQDPGFSYGSCSTGSQQSEGSKSSGSAQSSRWALGHEKERSVGCHAGGSSTESDHTALS
GVGSSWRECPDGQLSQGRSPRSQASATAPGLPTPHPATKAYTVVGGLPGGPPVRELAAIP
PELTRRQSFQKAMGNPCEFFVDIM
Download sequence
Identical sequences H9KW68
ENSCJAP00000009837 ENSCJAP00000009837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]