SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009921 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009921
Domain Number 1 Region: 302-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.11e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.19e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 4 Region: 49-104
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.06e-20
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 5 Region: 428-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 595-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 7 Region: 204-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 498-554
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.86e-17
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 9 Region: 387-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.27e-17
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 349-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000895
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000009921
Domain Number - Region: 163-219
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00202
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009921   Gene: ENSCJAG00000005418   Transcript: ENSCJAT00000010481
Sequence length 656
Comment pep:novel chromosome:C_jacchus3.2.1:22:11476079:11492660:-1 gene:ENSCJAG00000005418 transcript:ENSCJAT00000010481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALCYRIFWGYPKMLAAASLMEGLANISPWVTLRRGQPKVLGWGLPKDQDSVAFEDVAVN
FTHEEWALLGPTQKNLYRDVMQETIRNLNCIGMKWENQNTDDWYQNLRRNLRCDVVERFG
KSKDGSQCGETLSQIRNSIVNKNTPARVDACESSVNGEVIMGHSSLNCYIRVATGHKHRE
CHKYAEKPYTHKQDHSFRTRERPHTGEKLYDCKECGKTFSSPGNLRRHMVVQGGDGPYKC
ELCGKAFFWPSLLRMHERTHTGEKPYECKQCSKAFPAYSSYLRHEKIHTGEKPYECKQCS
KAFPDYSSYLRHERIHTGEKPYKCKQCGKAFSVSSSLRVHERIHTGEKPYMCKQCGKAFC
HLGSFQRHMIVHSGDGPHKCKICGKGFDFPGSVRIHEGTHTLEKPYECKQCGKLLSHRSS
FRRHMMAHTGDGPHKCTVCGKAFDSPSVFQRHERTHTGEKPYECKQCGKAFRISSSLRKH
ETTHTGDPPYKCKCGKAFGDFFSFQSHESTHSGEEPYECKECGKAFSSFKYFRHHERTHS
EEKSYECPTCGKAFTRFSYLKTHERTHTAEKPYECKQCRKAFFWPSFLVRHERIHTGERP
YECKHCGKAFSRSSFCREHERIHTGEKPYECKECGKAFSSLSSFNRHKRTHWKDIL
Download sequence
Identical sequences F7HHF5
ENSCJAP00000009921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]