SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009943 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009943
Domain Number 1 Region: 32-257
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.93e-26
Family beta-lactamase inhibitor protein-II, BLIP-II 0.084
Further Details:      
 
Domain Number 2 Region: 317-415
Classification Level Classification E-value
Superfamily POZ domain 0.00000463
Family BTB/POZ domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009943   Gene: ENSCJAG00000005450   Transcript: ENSCJAT00000010505
Sequence length 443
Comment pep:novel chromosome:C_jacchus3.2.1:12:75384048:75385492:-1 gene:ENSCJAG00000005450 transcript:ENSCJAT00000010505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGESGLFIFSNFFSEEELQLIHQACVFGSADHEVLYPTVSDEIFVPGTNYCDCLGLGNIQ
STIKPQTLDSLSGKMIASLSCGSGIHIVLATKGEVFTGHKAYSQPGTGTTNQGFSTNSSI
AYESHHSLVLISDGEVITLGYNNSGHVRSESSNQPVAQTVTGYLAVNTTYGQVCSMVAVD
TEKTAYAYRHTLVLTDEGQACFWGASYRQLGTGNKSNHSYPTFIIVEKDRIIEIAVCHSS
HISAAKTQGGHKYMWDQCQGQLAILPHLTHFCGDDAFACFAVPVITWCLLSVEPHLTVAE
SLKRESDNLDAAVLRSVIDGKYIYAHKVFLKIWCIYFHILFTGHSWNTCDTDSISPEEVV
GFLNLATFYKENHLKKVQQTIKQGICEQNAITLLSSAVKYDACDLEEFCFRFCINHPTIV
TNMDHDLLKNFISKESSVEAFKN
Download sequence
Identical sequences F7HHB0
ENSCJAP00000009943 ENSCJAP00000009943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]