SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010095 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010095
Domain Number 1 Region: 382-561
Classification Level Classification E-value
Superfamily SPOC domain-like 9.02e-50
Family SPOC domain 0.00032
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.3e-30
Family Canonical RBD 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010095   Gene: ENSCJAG00000005531   Transcript: ENSCJAT00000010667
Sequence length 563
Comment pep:novel chromosome:C_jacchus3.2.1:15:27148929:27154380:1 gene:ENSCJAG00000005531 transcript:ENSCJAT00000010667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQGGAYAFLKFQNL
DMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTI
DHVKGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLP
VHYELLTDGYTRHRNLDADLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYS
RSVRSRSGERWGGDGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERG
SDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERN
HRTMEAEPKPLEEPKHETKKLKNLSDYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVI
SSLLKDHTSGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATPSGLGTE
GMPTVEPGLQRRLLRNLVSYLKQKQAAGVISLPVGGSKGRDGTGMLYAFPPCEFSQQYLQ
SALRTLGKLEEEHMVIVIVRDTA
Download sequence
Identical sequences F7AB36
ENSCJAP00000010095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]