SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010753 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010753
Domain Number 1 Region: 10-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 81-124
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000248
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010753   Gene: ENSCJAG00000005863   Transcript: ENSCJAT00000011359
Sequence length 241
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:4449723:4451670:-1 gene:ENSCJAG00000005863 transcript:ENSCJAT00000011359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQ
YLRALHSADFPRGREKELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAF
LQSKARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGPGPFPWPPG
AARSPGLPYLPSAAVPLSSPAPQHSPFLTPVQCLDRHYLNRIGHAHPNALNLHTPQHPPV
L
Download sequence
Identical sequences F7ID41
XP_008990635.1.60252 ENSCJAP00000010753 ENSCJAP00000010753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]