SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010880 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010880
Domain Number 1 Region: 13-40,89-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-25
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.15e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010880   Gene: ENSCJAG00000005908   Transcript: ENSCJAT00000011490
Sequence length 309
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:40368200:40376147:-1 gene:ENSCJAG00000005908 transcript:ENSCJAT00000011490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAWLCSCWGGRVLPLLLAYVCYLLLGATIFQLLEKQAEAQSRNEFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNNLGTGLRAHLATIERWEDQPRRSQLLRVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFGEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLRLRQGCGAKEAPGRRPRGGSIAARGVQVTPQNF
ATSKRELGS
Download sequence
Identical sequences F7HMK7
XP_017826551.1.60252 ENSCJAP00000010880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]