SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011539 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011539
Domain Number 1 Region: 55-193
Classification Level Classification E-value
Superfamily PH domain-like 0.00000676
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011539   Gene: ENSCJAG00000006250   Transcript: ENSCJAT00000012173
Sequence length 200
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:99244541:99257875:1 gene:ENSCJAG00000006250 transcript:ENSCJAT00000012173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNSNSDTC
AEFRIKYVGAIEKLKLSEGEGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQA
QAICKVLSTAFDSVLTSEKP
Download sequence
Identical sequences F7IB20
ENSCJAP00000011527 ENSCJAP00000011539 XP_002758091.1.60252 XP_008979402.1.60252 XP_008979403.1.60252 XP_017820055.1.60252 XP_017820056.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]