SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011738 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011738
Domain Number 1 Region: 60-184
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000039
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 2 Region: 601-744
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 3 Region: 214-328
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000576
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000011738
Domain Number - Region: 435-553
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000198
Family Spectrin repeat 0.0091
Further Details:      
 
Domain Number - Region: 278-430
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00316
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011738   Gene: ENSCJAG00000006351   Transcript: ENSCJAT00000012381
Sequence length 958
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:121040029:121092493:-1 gene:ENSCJAG00000006351 transcript:ENSCJAT00000012381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQQPQEDFDRSVEDAQAWMKAVQDQLQVNDNTQGPREALEARLRETEKICQLEPEGRVK
VDLVLRTAEALLACCPGDQKPEILARLKDIKAQWEETVTYMTHCHSRIEWVWLHWSEYLL
ARDEFYRWFQKMMVTLEPHIELQLGLKEKQWQLSHAQVLLHNVDNQAVLLDRLLEEAASL
FNRIEDPSVDEDAQKRMKAEYDAVKAKAQDRVDLLERVAQEHEAYQAGVDEFQLWLKAVV
EKVNGCLGRDCKLPITQRLFTLQDIAKDFPRGEKSLERLEEQAVGVNRNTSPLGAEKITG
ELEEMRNVLEKLRALLEEEEERLRGLLKSRGACEQQIKRLEAELSEFRTVLQRLAQDSLQ
PVAKARTKDELVAHWRRYSATQAALASEEPRVARLQAQLKELMVFPHDLQPLSNSVVAAI
REYQSLKGKSARLRNAAGVELWQHFQRPLQDLQLWRALAQRLLEVTASLPDLPSLHTFLP
QIEAALMESSRLKEPLTMLQLKKDLLMGVFGQERATALLEQAAGSVRDRDLLHNSLLQRK
SKLQSLLTQHKDFGAAFEPLQKKLLDLQVRVQAEKGLQRDLPGKQAQLSRLQQGLQEEGL
DLGAQMEAVSPLVQENPNHQHKMDQLSSDFQALQRSLEDLVDRCQQSVQEHCTFSHQLLE
LRQWIAVTTQKLEAHQGDVGPGTAESQEAEFERLAAEFPEKEAHLSLVEAQGWLVMEKSS
PEGAGVVRAELRELAASWRALRLLEESLLSLIRNWHLQRIEVDSGKKMVFTNNIPKSGFL
INPVNPIPRRHRQVDLLQEEGSHEDFSQLLTNFEQWLQVENSKLVRIIAMRISTAEDLRT
REAKLQELEARVPEGQHLFENLLRLGPARGTSDELEDLRYQWMLYKSKLKDSSHLLTQSS
PGEPTGFQKSRRWQGLGSLFRRVCCVVPVREEDRSCTLANNFARSFTLMLRYNGPPPT
Download sequence
Identical sequences F7GCR5
ENSCJAP00000011738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]