SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011968 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011968
Domain Number 1 Region: 301-599
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.64e-86
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000249
Further Details:      
 
Domain Number 2 Region: 122-297
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 3.4e-44
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00069
Further Details:      
 
Domain Number 3 Region: 605-708
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 3.17e-23
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 61-122
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000262
Family TGS domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011968   Gene: ENSCJAG00000006429   Transcript: ENSCJAT00000012621
Sequence length 718
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:4466973:4485461:1 gene:ENSCJAG00000006429 transcript:ENSCJAT00000012621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLYQRWQQLRLQGLQAYGLHTAVVSTPPHWLAERLGLFEELWAAQVKRLASMAQKEPRT
IKISLPGGQKVDAVAWNTTPYQLARQISSTLADTAVAAQVNGELYDLERPLETDSDLRFL
TFDSPEGKAVFWHSSTHVLGAAAEQFLGAVLCRGPSTENGFYHDFFLGKERTIRGSELPV
LERICQELTAAAQPFRRLEASRDQLHRLFKDNPFKLHLIEEKITGPTATVYGCGTLVDLC
RGPHLRHTGQIGGLKLLSNSSSLWRSSGAPETLQRVSGISFPTAELLRAWEAWREKAGLQ
DHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFFEVKTPTLFSTK
LWEQSGHWEHYQEDMFAVQPPGSDRPASSQSDHSTRHTTDTLALKPMNCPAHCLMFAHRP
RSWRELPLRLADFGALHRAEASGGLCGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLR
SVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLQQALKEFGEPWDLNSGDGAFYGPKI
DVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLA
ESCRGKWPLWLSPFQVVVIPVGTEQEEYARETQQSLQAAGLVCDLDADSRLTLSRRIRRA
QLAHYNFQFVVGQKEQSKSTVNIRTRDNRLLGEWSLPEAVQRLVVLQNTRVPNAEEIF
Download sequence
Identical sequences F7FYX6
ENSCJAP00000011939 XP_002759919.1.60252 XP_008982521.1.60252 ENSCJAP00000011960 ENSCJAP00000011968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]