SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000011989 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000011989
Domain Number 1 Region: 141-316
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-50
Family SPRY domain 0.00000024
Further Details:      
 
Domain Number 2 Region: 45-122
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000033
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000011989   Gene: ENSCJAG00000006492   Transcript: ENSCJAT00000012642
Sequence length 332
Comment pep:novel chromosome:C_jacchus3.2.1:13:37983239:37985583:-1 gene:ENSCJAG00000006492 transcript:ENSCJAT00000012642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSGGDHTGGGRATRKKRVKALSPQDLSCWQKQLRPGEETREGETFAMAEPFKQVIRGPVC
LNDLEESVQLKCGYACCLQCINSLQKEPHGEGVLCPLCTVVSQKNDIKPRFKLRALISIL
KELKPKLKSILMMNPKMKKFQQQVDMTLDVDTASNYLINSEDQRSVQCGDFRQNRKEQAE
RFSSALCILGTSRFTSGCHYWEVDVGTSKGWDVGICEESVNIVLSSELGFWTVGSRKGKI
FAASTMPSTFLWVSPQLHRVGVFLVVGMRFISFSNVSYGCHIYTFNKIPVIEPLRPFFSD
KRETQDDQSFLSICPVINPDNASPPVYSGEKK
Download sequence
Identical sequences F7F7A0
ENSCJAP00000011989 ENSCJAP00000011989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]