SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000012054 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000012054
Domain Number 1 Region: 758-985
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 350-528
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.76e-55
Family Regulator of G-protein signaling, RGS 0.0000000196
Further Details:      
 
Domain Number 3 Region: 989-1123
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 27-121
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000012054
Domain Number - Region: 149-159
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00418
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000012054   Gene: ENSCJAG00000006413   Transcript: ENSCJAT00000012713
Sequence length 1568
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:11013210:11065430:-1 gene:ENSCJAG00000006413 transcript:ENSCJAT00000012713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTCFSYSFSRLSSLSSLGDSAPERRSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGIPGLQQDPFPAGAPRVTPAIPPPPPPPPLPPPQRITGPRPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEDYSRNPDSLLEEQMEGARRRVTQLQLKIQQETGGSVDILSLC
GDTGQRQSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVLSDPGLDSPRTSPVIMA
RVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKESRSLGKDIWSIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRLRTKRTLGLGSLYGENDLLD
LDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNAAEK
AQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSRLHLFLATG
KLLVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLK
GREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMG
RRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQ
EVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAM
KKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLF
MQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREI
LKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRI
SKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSV
ATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRHATRHPGAAPMPVHPPP
PGPQEPAHQGSTPSRVELDDSDVFHGEPEPEELPGGTGPQQRVQGKHPVLLEDPEQEGSA
EEEELGVLPCPSTSLDGENRGVRTRNPIHLAFPGPLFMEGLADSALEDVENLRRLILWSL
LPGHTMETQAAREPEDDVTPTPSVIGVTSHPWDPGSPGQALPGGEGDNTQIPGPEGERPE
QENMALCSLEDLPPRTRNSGIWESPELDRNPAEEASSTEAAGGYKVVRKAEVAGSKVVPA
LPESGQSEPEPPEVESGTKATGTGNCFYVSMPAGPLDSSTDLSGAPTSPPQPDSFPAGQI
EPQPQLQGGNGDPRCLSRSPPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLG
GESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPCPEDGSDTPLEESAA
DAATSPGP
Download sequence
Identical sequences F7GYQ5
ENSCJAP00000012054 ENSCJAP00000012054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]