SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014122 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014122
Domain Number 1 Region: 27-165
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.95e-44
Family DEP domain 0.000000175
Further Details:      
 
Domain Number 2 Region: 158-287
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-26
Family cAMP-binding domain 0.000000889
Further Details:      
 
Domain Number 3 Region: 284-386
Classification Level Classification E-value
Superfamily Ras GEF 0.000000000196
Family Ras GEF 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014122   Gene: ENSCJAG00000007525   Transcript: ENSCJAT00000014883
Sequence length 399
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:6:45486199:45581466:-1 gene:ENSCJAG00000007525 transcript:ENSCJAT00000014883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVFVLTPLIEPHVPLRPANTITKVPSEKILKAGKILRNAILSRAPHMIRDRKYHLKTYR
QCCVGTELVDWMMQQTPCVHSRTQAVGMWQVLLEDGVLNHVDQEHHFQDKYLFYRFLDDE
HEDAPLPTEEEKKECDEELQDTMLLLSQMGPDAHMRMILRKPPGQRTVDDLEIIYEELLH
IKALSHLSTTVKRELAGVLIFESHAKGGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVC
TLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQD
VLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEASLNEATDSVLNDF
IMMHCVFMPNTQLCPALVAHYHAQASRYRTGENGLCPQQ
Download sequence
Identical sequences F7IIY8
ENSCJAP00000014122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]