SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000014273 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000014273
Domain Number 1 Region: 1147-1342
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.75e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000236
Further Details:      
 
Domain Number 2 Region: 932-1055
Classification Level Classification E-value
Superfamily PH domain-like 2.38e-32
Family Pleckstrin-homology domain (PH domain) 0.000000497
Further Details:      
 
Domain Number 3 Region: 40-160
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-17
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000014273   Gene: ENSCJAG00000007642   Transcript: ENSCJAT00000015039
Sequence length 1956
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:22160217:22293624:-1 gene:ENSCJAG00000007642 transcript:ENSCJAT00000015039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDGDKLKACEVSKSKDGKEQSETVSLSEDETFSWPGPKTVMLKRTSQGFG
FTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCTG
DRIIRVNGESVIGKTYQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQDAY
LKGNEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEISPPDSSLSKQQTSTPVLTQPGR
AYKMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDMLSNRNNHTGPSHRTEEVR
YGTNEQTSLKTLSRTTSPPLSIPTAHLIHQTAGSRSLEPSGILLKSGNYSGHSDGISSSR
SQAVESPSVAVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQST
ADYNQVVPNRTTLQGRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGALT
SPSVSFSNHRTRSWDYIEGQDETLENVNSGTPIPDSNGERKQTYKWSGFTEQDDRRGIYE
RPRQQEIHKSFRGSNFTVAPSVVNSDNRRMSGRGVGSVSQFKKVPPDLKTLQSNRHFQTT
CGMSLPRGISQDRSPLVKVGSNSQKAPSTHVTKPSFSQKSFVSIKDQRPVNHLHQNSLLN
QQTWVRTDSTPDQQVETGKSPSLSGASAKPAPQSSENAGTSDLELPVSQRNQDLSLQEAE
IEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARREVH
IKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIATVP
HSLTTSAPLIRRQLSHDHESVSPPSLDAQPTSKTERSKSYDEGLDDYKEDAKLSFKHVSS
LKGIKIPDSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQMY
VVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLFQA
EDRDDMLSWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPRQSLSIR
QTLLGAKSEPKTQSPHSPKEESERKLLSKEWQLEDDTSPPKDKGTWRKGIPSIMRKTFEK
KPTATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQE
ELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLK
TLKRLIRDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHM
VTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGV
SPGDVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDEL
DNVFFKKENVEQCLNDTKEESKKESETLGRKQRIITAKETGTRKDPSTTKDEKVSLGKES
MPSEEPSKHNKSPTLSCRFAILKESPRSLLAQKSSHLEETGSDSGTLLSTSSQASLARFS
MKKSTSPETKHSEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSMAESRGDEADDE
RSELISEGRPVETDSESEFPIFPTALTSERLFRGKLQEVTKSSRRNSEGSEVSCTEGSLT
SSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDTKNEKEAPSISKVFDVMKKGKS
TGSLLTPTRGESEKQEPTWKTKIADRLKLKPRAPADDMFGVGSHKANAETAKRKSIRRRH
TLGGHRDATEISILNFWKVHEQSGGRESELSAVNRLKPKCSAQDLSISDWLARERLRTST
SDLSRGESGDPQTENPSTRETATTDTSLSFQSDTGSSSSTLASTNRPLLSIPPQSPDQIN
GESFQDVSKNASSAANAQPHKLSETPGNKAQFHPCL
Download sequence
Identical sequences F7ITB9
ENSCJAP00000014273 ENSCJAP00000014264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]