SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000016091 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000016091
Domain Number 1 Region: 16-387
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.66e-68
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 407-521,640-780
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.67e-66
Family Phosphate binding protein-like 0.00000000105
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000016091
Domain Number - Region: 490-635
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000706
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000016091   Gene: ENSCJAG00000008672   Transcript: ENSCJAT00000017004
Sequence length 910
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:21:33403262:33556154:-1 gene:ENSCJAG00000008672 transcript:ENSCJAT00000017004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISR
AILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMKLIKEARWDGLTGRITFNKTNGLRKDFDLDIISLKEEG
TEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPY
VMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKE
LIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIW
MYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGS
ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGA
VRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEY
VTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC
PEEDNKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQKGKSSRIRFY
FRNKVRFHGRKKQSLGVEKCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQ
RRTQRKETVA
Download sequence
Identical sequences F6V6U8
ENSCJAP00000016086 ENSCJAP00000016091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]