SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018027 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018027
Domain Number 1 Region: 344-516
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.78e-42
Family Ribonuclease PH domain 1-like 0.0000452
Further Details:      
 
Domain Number 2 Region: 49-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.54e-36
Family Ribonuclease PH domain 1-like 0.00011
Further Details:      
 
Domain Number 3 Region: 185-274
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.17e-23
Family Ribonuclease PH domain 2-like 0.0021
Further Details:      
 
Domain Number 4 Region: 268-369
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.27e-23
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000792
Further Details:      
 
Domain Number 5 Region: 502-602
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-21
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 6 Region: 596-686
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.0027
Further Details:      
 
Domain Number 7 Region: 677-756
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000024
Family Cold shock DNA-binding domain-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018027   Gene: ENSCJAG00000009740   Transcript: ENSCJAT00000019055
Sequence length 788
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:14:51666533:51728565:1 gene:ENSCJAG00000009740 transcript:ENSCJAT00000019055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACRRCCSCLRLRPLSDGPFRLPGRNRALNQLQVRALWGSAGSRAVAVDLGTRKLEISS
GKLARFADGSAVVQSGDTAVMVTVVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGTSDKEILTSRVIADRSIRPLFPAGYFYDTQVLCNLLAVDGINEPDVLAINGASVALSL
SDIPWNGPVGAVRIGMIDGECVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQ
DFCHAIKFGVKYTQQIIQGIQQLVKEIGVTKRTPQKLFTPSPEIVKHAHKLTMEKLYAVF
TDYEHDKISRDEAVNKIRLDTEEQLKEKFPEADPFEIIESFNVVAKEVFRSIILNEYKRC
DGRDLTSLRNVSCEVDMFKTLHGSALFQRGQTQVLCTVTFDSLESSIKSDQVITAINGIK
DKNFMLHYEFPPYATNEIGKVTGLNRRELGHGALAEKALYPVIPKDFPFTIRVTSEVLES
NGSSSMASACGGSLALMDSVIGVPISSAVAGVAIGLVTKTDPEKGEIDDYRLLTDILGIE
DYNGDMDFKMAGTNKGITALQADIKLPGIPIKIVMEAVQQASVAKKEILQIMNKTISKPR
ASRKENGPIVETVQVPLSKRAKFVGPGGYNLKKLQAETGVTVSQVDEETFSVFAPTPSAM
HEARDFITEICKDDQEQQLEFGAVYTATITEISRDTGVMVKLYPNMTAVLLHNTQLDQRK
IKHPTALGLEVGQEIQVKYFGRDPADGRMRLSRKVLQSPATTVVRTLNDRSSIVMGEPLS
QSSSHSSQ
Download sequence
Identical sequences F7GWJ1
ENSCJAP00000018027 ENSCJAP00000018027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]