SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018264 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000018264
Domain Number - Region: 36-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00132
Family Eukaryotic type KH-domain (KH-domain type I) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018264   Gene: ENSCJAG00000009945   Transcript: ENSCJAT00000019297
Sequence length 117
Comment pep:novel chromosome:C_jacchus3.2.1:4:71626860:71627833:-1 gene:ENSCJAG00000009945 transcript:ENSCJAT00000019297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLPERRNIPPWVKVPEDLKDPEVFQVQTRLLEAMFAGRDGCRIPYIEQVSKAMLELKA
LESPDFTEVVVYGSYIYKLRAKWMLQSMAEWHRQRQERGMLKLEEAMNALELSPWMN
Download sequence
Identical sequences F7G9E9
ENSCJAP00000018264 ENSCJAP00000018264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]