SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018415 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018415
Domain Number 1 Region: 123-421
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-57
Family G proteins 0.00000861
Further Details:      
 
Domain Number 2 Region: 589-719
Classification Level Classification E-value
Superfamily Translation proteins 5.61e-34
Family Elongation factors 0.0013
Further Details:      
 
Domain Number 3 Region: 465-585
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 6.67e-33
Family Initiation factor IF2/eIF5b, domain 3 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018415   Gene: ENSCJAG00000009960   Transcript: ENSCJAT00000019456
Sequence length 721
Comment pep:novel chromosome:C_jacchus3.2.1:14:3522510:3558572:1 gene:ENSCJAG00000009960 transcript:ENSCJAT00000019456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQGVPEKEETPPPVEPEEEEDTEDTGLDDWEAMASDEETEKVLVEGNTVHIEVKENREG
SEGDEEDEKVSDEKDSGKTLDKKPSKEMSSDSEYDSDDDRTKEERAYDKAKRRIEKRRLE
HSKNVNTEKLRAPIICVLGHVDTGKTKILDKLRHTHVQDGEAGGITQQIGATNVPLEAIN
EQTKMIKNFDRENVRIPGMLIIDTPGHESFSNLRNRGSSLCDIAILVVDIMHGLEPQTIE
SINLLKSKKCPFIVALNKIDRLYDWKKSPDSDVAATLKKQKKNTKDEFEERAKAIIVEFA
QQGLNAALFYENKDPRTFVSLVPTSAHTGDGMGSLIYLLVELTQTMLSKRLAHCEELRAQ
VMEVKALPGMGTTVDVILINGRLKEGDTIIVPGVEGPIVTQIRGLLLPPPMKELRVKNQY
EKHKEVEAAQGVKILGKDLEKTLAGLPLLVAYKEDEIPVLKDELIHELKQTLNAIKLEEK
GVYVQASTLGSLEALLEFLKTSEVPYAGINIGPVHKKDVMKASVMLEHDPQYAVILAFDV
RIERDAQEMADSLGVRIFSAEIIYHLFDAFTKYRQDYKKQKQEEYKHIAVFPCKMKILPQ
YIFNSRDPIVMGVTVEAGQVKQGTPMCVPSKNFVDIGIVTSIEINHKQVDVAKKGQEVCV
KIEPIPGESPKMFGRHFEATDILVSKISRQSIDALKDWFRDEMQKSDWQLIVELKKVFEI
I
Download sequence
Identical sequences F7H662
ENSCJAP00000018415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]