SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000018714 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000018714
Domain Number 1 Region: 906-1198
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.52e-85
Family Complement components 0.0000158
Further Details:      
 
Domain Number 2 Region: 1279-1407
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.32e-31
Family Alpha-macroglobulin receptor domain 0.0016
Further Details:      
 
Domain Number 3 Region: 742-795
Classification Level Classification E-value
Superfamily E set domains 0.00000000238
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000018714   Gene: ENSCJAG00000010082   Transcript: ENSCJAT00000019767
Sequence length 1445
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:71916978:72073493:1 gene:ENSCJAG00000010082 transcript:ENSCJAT00000019767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGPPLLTAAHLLCVCTAALAAAPGPRFLVTAPGIIRPGGNVTIGVELLEHCPSQVTVKA
ELLKTTSNLTVSVLQAEGVFEKGSIKTLTLPSLPLNSANGIYELRVTGRAQDEILFSNST
RLSFETKRISVFIQTDKTLYKPKQEVKFRIVTLFSDFKPYKTSLNILIKDPKSNLIQQWL
SQQSDLGVVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFDVALQTPLYCS
MNSKHLNGTITAKYTYGKPVKGDVTLTFLPLSFWGEKKSITKTFQINGSANFSFNDEEMK
DVMDFSNGLSEHIDLSSPGPVEILATVTESLTGISRNASTNVFFKQHDYIIEFFDYTTVL
KPSLNFTATVKVTRADGNQLTLEERRNNVVITVTQTNYTENWGRSNNGNQKMEAVQKINY
TVPQNGIFKIEFPILEDSSELQLKAYFLGSKSSMAVHSLFKSPSKTYIQLKTRDENIKVG
LPFELVVSGNKQLKELSYMVVSRGQLVAVGKQNSTIFSLTPENSWTPKACIIVYYIEDDG
EIINDVLKIPVQLVFKNKIKLYWSKAKAEPSEKVSLRISVTQPDSVVGIVAVDKSVNLMN
ASNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDADLREDYIDGVYDHPEY
AERFMDETEGHIIDINGFSLDSSPRVRKHFPETWIWLDTNMGSRIYQEFEVTVPDSITSW
VATGFVVSDDLGLGLTTTPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEV
KVIVEKSDTFDILMTSNEINATGHQQTILVPSEDGATVLFPIKPTHLGEIPITVTALSPT
ASDAITQMIFVKAEGIEKLYSQSVLLDLTDNRLQSTLKTLSFSFPPNTVTGSERVQITAI
GDVLGPSINGLASLIRMPYGCGEQNMINFAPNIYILDYLTKKKQLTDNLKEKALSFMRQG
YQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGR
QKSNGEFWEPGRVIHSELQSGNKSPVTLTAYIVTSLLGYRKYQPNIDVQESINFLESEFS
REILDNYTLALITYALSSVGSPKAKEALNMLTWRAEEEGGMQFWVSSESKLSDSWQPRSL
DIEVAAYALLSHFLQFQASEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALMNT
ERTNIQVTVMGPSSPSPVNFRIDTHNRLLLQTAELAVVQPTAVNISASGFGFAICQLNVV
YNVKDFESPRRRRSIQNQEAFDLDVAVKDNKDDPNHVDLNVCTRFWGPDRSGMALMEVNL
LSGFMVPSDAIPLSETVKKVEYDHGKLNLYLDSVNETQFCVDIPAVRNFKVSNTQDASVF
IVDYYEPRRLAVRSYNSEAKLSSCDLCRDVQGCRPCEDGASGSHHPSSVIFISCLTLLYF
LQLRL
Download sequence
Identical sequences F7F2Y8
XP_002746776.1.60252 ENSCJAP00000018616 ENSCJAP00000018714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]