SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019113 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000019113
Domain Number - Region: 31-99
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0417
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019113   Gene: ENSCJAG00000010374   Transcript: ENSCJAT00000020191
Sequence length 279
Comment pep:novel scaffold:C_jacchus3.2.1:ACFV01181611.1:103:14168:-1 gene:ENSCJAG00000010374 transcript:ENSCJAT00000020191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRKTLNECENGEFSFHGDLKTSPFEMDIQINKLKHKIDDLTAELETAGSKCLHLDTKNQ
VLQQELLSMKTIQKKCEKLQKNKEKLEQEVVNLRSHLERNMVERGQVKQYKQEIEERARQ
EIVEKLKEVNLFLQAQAASQENLEQLRENSFASMKSQMELRINDLESELSKMKTFQEDVN
KTELEKYKQLYLEELKVRKSLSNKLNKTNERLAEVNTKLLMEKQQTRSLFTTLTTRPVLV
SPCVGNLNNSLDLNRKLIPRENVVIPTSNPRTSNNSTEK
Download sequence
Identical sequences H9KWN4
ENSCJAP00000019113 ENSCJAP00000019113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]