SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019157 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019157
Domain Number 1 Region: 118-243
Classification Level Classification E-value
Superfamily Spectrin repeat 7.72e-22
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 2 Region: 32-147
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000101
Family Spectrin repeat 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019157   Gene: ENSCJAG00000010349   Transcript: ENSCJAT00000020236
Sequence length 245
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:57884087:57894762:-1 gene:ENSCJAG00000010349 transcript:ENSCJAT00000020236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPGEGFSIQEKYVAADTLYSQIKEDVKKRAVALDEAISQSTQFHDKIDQILESLERIVE
RLRQPPSISAEVEKIKEQISENKNVSVDMEKLQPLYETLKQRGEEMIARSGGTDKDISAK
AVQDKLDQMVFIWENIHTLVEEREAKLLDVMELAEKFWCDHMSLVVTIKDTQDFIRDLED
PGIDPSVVKQQQEAAEAIREEIDGLQEELDIVMNLGSELIAACGEPDKPIVKKSIDELNS
AWDSK
Download sequence
Identical sequences F6R0Z8
ENSCJAP00000019157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]