SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000019301 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000019301
Domain Number 1 Region: 4-554
Classification Level Classification E-value
Superfamily SIS domain 1.11e-233
Family Phosphoglucose isomerase, PGI 9.78e-16
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000019301   Gene: ENSCJAG00000010910   Transcript: ENSCJAT00000020387
Sequence length 558
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:28684114:28718139:1 gene:ENSCJAG00000010910 transcript:ENSCJAT00000020387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALTRDPQFQKLQQWYREHGSELNLRRLFDTDEERFNHFSLTLNTNHGHILVDYSKNLV
TEEVMRMLVDLAKSRGVETARERMFNGEKINYTEGRAVLHVALRNRSNTPILVDGKDVMP
EVNKVLDKMKSFCQRVRSGDWKGYTGKTITDVINIGIGGSDLGPLMVTEALKPYSSGGPR
VWYVSNIDGTHIAKTLAQLNPESSLFIIASKTFTTQETITNAETAKEWFLQVAKDPSAVA
KHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSIALHVGFDNFEQLLSGA
HWMDQHFRTTPLEKNAPILLALLGIWYINCFGCETHAMLPYDQYLHRFAAYFQQGDMESN
GKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPCDFLIPVQTQHPIRKGL
HHKILLANFLAQTEALMRGKSTDEARKELQAAGKSPEDLEKLLPHKVFEGNRPTNSIVFT
KLTPFMLGALVAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKKIEPELDGSAQVTSHDA
STNGLINFIKQQREARVQ
Download sequence
Identical sequences F6RXE9
ENSCJAP00000019301 XP_017823257.1.60252 XP_017823258.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]